RENT1 / hUPF1 Antibody
-
Catalog numberR32296
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenRENT1 / hUPF1
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB, IHC-P
-
Recommended dilutionsWestern blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
-
NotesOptimal dilution of the UPF1 antibody should be determined by the researcher.
-
Intented useThis UPF1 antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotQ92900
-
PurityAntigen affinity
-
DescriptionRegulator of nonsense transcripts 1 is a protein that in humans is encoded by the UPF1 gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. And this protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Alternative splicing results in multiple transcript variants.
-
ImmunogenAmino acids NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE of human UPF1 were used as the immunogen for the UPF1 antibody.
-
StorageAfter reconstitution, the UPF1 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
LocalizationCytoplasmic
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolUPF1
-
Short nameAnti-RENT1 / hUPF1
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to RENT1 / hUPF1
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene nameUPF1 RNA helicase and ATPase
-
Synonyms gene
-
Synonyms gene name
- regulator of nonsense transcripts 1
- UPF1 regulator of nonsense transcripts homolog (yeast)
- UPF1, RNA helicase and ATPase
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1997-02-11
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- UPF1 like RNA helicases
- SURF complex
- DECID complex
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data