Peroxiredoxin 4 Antibody / PRDX4

• Catalog number
  R32208
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  Peroxiredoxin 4 / PRDX4
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB, IHC-P, ICC
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml,ICC: 0.5-1ug/ml
• Notes
  Optimal dilution of the Peroxiredoxin 4 antibody should be determined by the researcher.
• Intented use
  This Peroxiredoxin 4 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  Q13162
• Purity
  Antigen affinity
• Description
  PRDX4 (Peroxiredoxin 4) is also known as AOE37-2. The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. Functional analysis showed that PRDX4 protects glutamine synthetase from inactivation. Yeast 2-hybrid, immunoprecipitation, and immunoblot analyses indicated that PRDX4 and PRDX1 are capable of homodimerization and heterodimerization with each other but not with the mitochondrial PRDX3. Gel mobility shift and immunoblot analysis found that PRDX4 depletes NFKB binding activity together with a reduction in the amounts of p50, p65, and phosphorylated IKBA, as well as a reduction in the expression of HIV-1 viral proteins. Expression of PRDX4, alone or with PRDX1, increased the resistance of yeast cells to oxidant-induced toxicity. Jin et al. suggested PRDX4 modulates IKBA phosphorylation in the cytoplasm and thus affects a peroxiredoxin-dependent redox step.
• Immunogen
  Amino acids SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK of human Peroxiredoxin 4 were used as the immunogen for the Peroxiredoxin 4 antibody.
• Storage
  After reconstitution, the Peroxiredoxin 4 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Localization
  Cytoplasmic
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  Peroxiredoxin   PRDX4  
• Gene symbol
  PRDX4
• Short name
  Anti-Peroxiredoxin 4 / PRDX4
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to Peroxiredoxin 4 / PRDX4
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:17169
• Gene
  PRDX4
• Long gene name
  peroxiredoxin 4
• Synonyms
  • AOE37-2
• GenBank acession
  • U25182
• Locus
  Xp22.11
• Discovery year
  2001-11-14
• Entrez gene record
  10549
• Pubmed identfication
  • 9388242
• RefSeq identity
  • NM_006406
• Classification
  • Peroxiredoxins
• VEGA ID
  OTTHUMG00000021253
• Locus Specific Databases
  • Global Variome shared LOVD

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products