PAR2 Antibody / F2RL1 / Thrombin Receptor-like 1
-
Catalog numberR32144
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenPAR2 / F2RL1 / Thrombin Receptor-like 1
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB
-
Recommended dilutionsWestern blot: 0.1-0.5ug/ml
-
NotesOptimal dilution of the PAR2 antibody should be determined by the researcher.
-
Intented useThis PAR2 antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotP55085
-
PurityAntigen affinity
-
DescriptionProtease activated receptor 2 (PAR2), also known ascoagulation factor II (thrombin) receptor-like 1 (F2RL1) or G-protein coupled receptor 11 (GPR11), is a protein that in humans is encoded by the F2RL1 gene. F2RL1 is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F2RL1 gene contains two exons and is widely expressed in human tissues. Additionally, PAR2 modulates inflammatory responses and acts as a sensor for proteolytic enzymes generated during infection.
-
ImmunogenAmino acids HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS of human F2RL1/PAR2 were used as the immunogen for the PAR2 antibody.
-
StorageAfter reconstitution, the PAR2 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
Additional descriptionThe receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
-
French translationanticorps
-
Gene target
-
Gene symbolF2RL1, NR1I2, SLC52A1
-
Short nameAnti-PAR2 / F2RL1 / Thrombin Receptor-like 1
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to PAR2 / F2RL1 / Thrombin Receptor-like 1
-
Alternative techniqueantibodies
-
Alternative to gene targetcoagulation factor II (thrombin) receptor-like 1, GPR11 and PAR2, F2RL1 and IDBG-29713 and ENSG00000164251 and 2150, G-protein beta-subunit binding, Plasma membranes, F2rl1 and IDBG-173973 and ENSMUSG00000021678 and 14063, BT.28745 and IDBG-645161 and ENSBTAG00000034848 and 526525
-
Gene info
-
Identity
-
Gene
-
Long gene nameF2R like trypsin receptor 1
-
Synonyms gene
-
Synonyms gene name
- coagulation factor II (thrombin) receptor-like 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1997-10-27
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- F2R receptors
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namenuclear receptor subfamily 1 group I member 2
-
Synonyms gene name
- nuclear receptor subfamily 1, group I, member 2
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1999-04-23
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Nuclear receptor subfamily 1 group I
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namesolute carrier family 52 member 1
-
Synonyms gene
-
Synonyms gene name
- G protein-coupled receptor 172B
- solute carrier family 52 (riboflavin transporter), member 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2004-07-19
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Solute carriers
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data