NONO Antibody / p54nrb
-
Catalog numberR32235
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenNONO / p54nrb
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB, IHC-P
-
Recommended dilutionsWestern blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
-
NotesOptimal dilution of the p54nrb antibody should be determined by the researcher.
-
Intented useThis p54nrb antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotQ15233
-
PurityAntigen affinity
-
DescriptionNon-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene. This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.
-
ImmunogenAmino acids MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ of human NONO/p54nrb were used as the immunogen for the p54nrb antibody.
-
StorageAfter reconstitution, the p54nrb antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
LocalizationNuclear
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolNONO
-
Short nameAnti-NONO / p54nrb
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to NONO / p54nrb
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene namenon-POU domain containing octamer binding
-
Synonyms gene name
- non-POU-domain-containing, octamer-binding
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1992-02-06
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Protein phosphatase 1 regulatory subunits
- RNA binding motif containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data