-
Category
Antibody
-
Concentration
0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
Form
Antigen affinity purified
-
Conjugation
Unconjugated
-
Clone
Polyclonal antibody
-
Recognised antigen
Mineralocorticoid Receptor / MR
-
Host animal
Rabbit (Oryctolagus cuniculus)
-
Clonality
Polyclonal (rabbit origin)
-
Species reactivity
Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applications
WB
-
Recommended dilutions
Western blot: 0.1-0.5ug/ml
-
Notes
Optimal dilution of the MR antibody should be determined by the researcher.
-
Intented use
This MR antibodyis to be used only for research purposes and not for diagnostics..
-
Uniprot
P08235
-
Purity
Antigen affinity
-
Description
NR3C2 (nuclear receptor subfamily 3, group C, member 2), also known as MR (mineralocorticoid receptor), is a protein that in humans is encoded by the NR3C2 gene that is located on chromosome 4q31.1-31.2. It belongs to the nuclear receptor family where the ligand diffuses into cells, interacts with the receptor and results in a signal transduction affecting specific gene expression in the nucleus. This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants.
-
Immunogen
Amino acids HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK of the human protein were used as the immunogen for the MR antibody. This sequence is common to isoforms 1, 3 and 4.
-
Storage
After reconstitution, the MR antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
Properties
If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
Additional description
The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
-
French translation
anticorps
