LOXL2 Antibody

• Catalog number
  R32365
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  LOXL2
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml
• Notes
  Optimal dilution of the LOXL2 antibody should be determined by the researcher.
• Intented use
  This LOXL2 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  Q9Y4K0
• Purity
  Antigen affinity
• Description
  Lysyl oxidase homolog 2 is an enzyme that in humans is encoded by the LOXL2 gene. This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. LOXL2 can also crosslink collagen type IV and hence influence the sprouting of new blood vessels.
• Immunogen
  Amino acids HRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQ of human Lysyl oxidase homolog 2 were used as the immunogen for the LOXL2 antibody.
• Storage
  After reconstitution, the LOXL2 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  LOXL2  
• Gene symbol
  LOXL2
• Short name
  Anti-LOXL2
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to LOXL2
• Alternative technique
  antibodies
• Alternative to gene target
  lysyl oxidase-like 2, LOR2 and WS9-14, LOXL2 and IDBG-11841 and ENSG00000134013 and 4017, oxidoreductase activity, nuclei, Loxl2 and IDBG-177377 and ENSMUSG00000034205 and 100862072,94352, LOXL2 and IDBG-635071 and ENSBTAG00000006214 and 532684

Gene info

• Identity
  HGNC:6666
• Gene
  LOXL2
• Long gene name
  lysyl oxidase like 2
• Synonyms gene name
  • lysyl oxidase-like 2
• Synonyms
  • WS9-14
  • LOR
• GenBank acession
  • U89942
• Locus
  8p21.3
• Discovery year
  1997-11-10
• Entrez gene record
  4017
• Pubmed identfication
  • 9722957
• Classification
  • Scavenger receptor cysteine rich domain containing
• VEGA ID
  OTTHUMG00000163797

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products