KDM5B Antibody / Jarid1B
-
Catalog numberR32541
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenKDM5B / Jarid1B
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB
-
Recommended dilutionsWestern blot: 0.5-1ug/ml
-
Added bufferLyophilized from 1X Phosphate Buffered Saline (PBS) with 2.5% BSA and 0.025% sodium azide
-
Intented useThis KDM5B antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotQ9UGL1
-
PurityAntigen affinity
-
DescriptionLysine-specific demethylase 5B, also known as histone demethylase JARID1B, is a demethylase enzyme that in humans is encoded by the KDM5B gene. This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing resultsi n multiple transcript variants.
-
ImmunogenAmino acids 641-685 (DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELL) from the human protein were used as the immunogen for the KDM5B antibody.
-
StorageAfter reconstitution, the KDM5B antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolKDM5B, PCAT6
-
Short nameAnti- KDM5B / Jarid1B
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to KDM5B / Jarid1B
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene namelysine demethylase 5B
-
Synonyms gene
-
Synonyms gene name
- Jumonji, AT rich interactive domain 1B (RBP2-like)
- jumonji, AT rich interactive domain 1B
- lysine (K)-specific demethylase 5B
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2004-01-28
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- PHD finger proteins
- Lysine demethylases
- AT-rich interaction domain containing
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameprostate cancer associated transcript 6
-
Synonyms gene
-
Synonyms gene name
- KDM5B antisense RNA 1 (head to head)
- prostate cancer associated transcript 6 (non-protein coding)
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2012-02-02
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Long non-coding RNAs with non-systematic symbols
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data