IKAROS Antibody / IKZF1

• Catalog number
  R32214
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  IKAROS / IKZF1
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB, IHC-P
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
• Notes
  Optimal dilution of the IKAROS antibody should be determined by the researcher.
• Intented use
  This IKAROS antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  Q13422
• Purity
  Antigen affinity
• Description
  DNA-binding protein Ikaros is a protein that in humans is encoded by the IKZF1 gene. This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions as a regulator of lymphocyte differentiation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. Most isoforms share a common C-terminal domain, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, and for interactions with other proteins. The isoforms, however, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, resulting in members with and without DNA-binding properties. Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes. The non-DNA-binding isoforms are largely found in the cytoplasm, and are thought to function as dominant-negative factors.
• Immunogen
  Amino acids LKEEHRAYDLLRAASENSQDALRVVSTSGEQM of human IKZF1 were used as the immunogen for the IKAROS antibody.
• Storage
  After reconstitution, the IKAROS antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Localization
  Nuclear
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  IKAROS   IKZF1  
• Gene symbol
  IKZF1
• Short name
  Anti-IKAROS / IKZF1
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to IKAROS / IKZF1
• Alternative technique
  antibodies
• Alternative to gene target
  IKAROS family zinc finger 1 (Ikaros), Hs.54452 and IK1 and IKAROS and LyF-1 and LYF1 and PPP1R92 and PRO0758 and ZNFN1A1, IKZF1 and IDBG-16397 and ENSG00000185811 and 10320, protein heterodimerization activity, nuclei, Ikzf1 and IDBG-150234 and ENSMUSG00000018654 and 22778, BT.93003 and IDBG-628786 and ENSBTAG00000014016 and 541154

Gene info

• Identity
  HGNC:13176
• Gene
  IKZF1
• Long gene name
  IKAROS family zinc finger 1
• Synonyms gene
  • ZNFN1A1
• Synonyms gene name
  • zinc finger protein, subfamily 1A, 1 (Ikaros)
  • IKAROS family zinc finger 1 (Ikaros)
• Synonyms
  • hIk-1
  • LyF-1
  • Hs.54452
  • IKAROS
  • PPP1R92
• Synonyms name
  • protein phosphatase 1, regulatory subunit 92
• GenBank acession
  • U40462
• Locus
  7p12.2
• Discovery year
  1999-08-23
• Entrez gene record
  10320
• Pubmed identfication
  • 1439790
  • 7935426
• RefSeq identity
  • NM_006060
• Classification
  • Zinc fingers C2H2-type
  • Protein phosphatase 1 regulatory subunits
• VEGA ID
  OTTHUMG00000155907
• Locus Specific Databases
  • LRG_1121

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products