HuD Antibody / ELAVL4

• Catalog number
  R32036
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  HuD / ELAVL4
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB, IHC-P
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
• Notes
  Optimal dilution of the HuD antibody should be determined by the researcher.
• Intented use
  This HuD antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  P26378
• Purity
  Antigen affinity
• Description
  HuD, otherwise known as ELAV-like protein 4 or PNEM, is a protein that in humans is encoded by the ELAVL4 gene. This human gene is located at 1p34 by in situ hybridization. The HuD/ELAVL4 protein is anRNA-binding protein. ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs. And HuD is expressed only in neurons and it binds toAU-rich element-containing mRNAs. As a result of this interaction the, half-life of the transcript is increased. Also, HuD is important in neurons during brain development and plasticity.
• Immunogen
  Amino acids MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK of human ELAVL4/HuD were used as the immunogen for the HuD antibody.
• Storage
  After reconstitution, the HuD antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Localization
  Nuclear
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  HuD   ELAVL4  
• Gene symbol
  ELAVL4-AS1, ELAVL4
• Short name
  Anti-HuD / ELAVL4
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to HuD / ELAVL4
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:40210
• Gene
  ELAVL4-AS1
• Long gene name
  ELAVL4 antisense RNA 1
• Locus
  1p33
• Discovery year
  2019-07-25
• Entrez gene record
  107984955
• Classification
  • Antisense RNAs

Gene info

• Identity
  HGNC:3315
• Gene
  ELAVL4
• Long gene name
  ELAV like RNA binding protein 4
• Synonyms gene
  • HUD
• Synonyms gene name
  • ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)
  • ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4
  • ELAV like neuron-specific RNA binding protein 4
• Synonyms
  • PNEM
• Synonyms name
  • Hu antigen D
• GenBank acession
  • AY033998
• Locus
  1p33-p32.3
• Discovery year
  1993-07-12
• Entrez gene record
  1996
• Pubmed identfication
  • 8222755
• RefSeq identity
  • NM_021952
• Classification
  • RNA binding motif containing
• VEGA ID
  OTTHUMG00000007877

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products