HMGB2 Antibody

• Catalog number
  R32439
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  HMGB2
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB, IHC-P
• Recommended dilutions
  Western blot: 0.5-1ug/ml,IHC (FFPE): 1-2ug/ml
• Added buffer
  Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2.5% BSA and 0.025% sodium azide
• Intented use
  This HMGB2 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  P26583
• Purity
  Antigen affinity
• Description
  High-mobility group protein B2, also known as high-mobility group protein 2 (HMG-2), is a protein that in humans is encoded by the HMGB2 gene. This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.
• Immunogen
  Amino acids KSDKARYDREMKNYVPPKGDKKGKKKDPNAPKR were used as the immunogen for the HMGB2 antibody.
• Storage
  Prior to reconstitution, store at 4oC. After reconstitution, the HMGB2 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Localization
  Nuclear
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  HMGB2  
• Gene symbol
  HMGB2
• Short name
  Anti- HMGB2
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to HMGB2
• Alternative technique
  antibodies
• Alternative to gene target
  high mobility group box 2, HMG2, HMGB2 and IDBG-44657 and ENSG00000164104 and 3148, DNA binding, nuclei, Hmgb2 and IDBG-156235 and ENSMUSG00000054717 and 97165, HMGB2 and IDBG-629304 and ENSBTAG00000015101 and 540444,618297

Gene info

• Identity
  HGNC:5000
• Gene
  HMGB2
• Long gene name
  high mobility group box 2
• Synonyms gene
  • HMG2
• Synonyms gene name
  • high-mobility group (nonhistone chromosomal) protein 2
  • high-mobility group box 2
• Locus
  4q34.1
• Discovery year
  1993-12-13
• Entrez gene record
  3148
• Pubmed identfication
  • 1754403
• RefSeq identity
  • NM_001130688
• Classification
  • Canonical high mobility group
  • SET complex
• VEGA ID
  OTTHUMG00000160799

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products