HDAC6 Antibody

• Catalog number
  R32342
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  HDAC6
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml
• Notes
  Optimal dilution of the HDAC6 antibody should be determined by the researcher.
• Intented use
  This HDAC6 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  Q9UBN7
• Purity
  Antigen affinity
• Description
  HDAC6, also called KIAA0901, is a member belongs to class II of the histone deacetylase/acuc/apha family of proteins that is an enzyme that in humans is encoded by the HDAC6 gene. The HDAC6 gene is mapped to chromosome Xp11.23. HDAC6 contains an internal duplication of two catalytic domains which appear to function independently of each other. The protein possesses histone deacetylase activity and represses transcription. HDAC6 functions as a tubulin deacetylase. And it is localized exclusively in the cytoplasm, where it associates with microtubules and localizes with the microtubule motor complex. HDAC6 could bind both polyubiquitinated misfolded proteins and dynein motors, thereby recruiting misfolded protein cargo to dynein motors for transport to aggresomes. Furthermore, expression of HDAC6 was sufficient to rescue degeneration associated with UPS dysfunction in vivo in an autophagy-dependent manner. HDAC6 is a central component of the stress response that regulates SG formation and potentially contributes to control of RNA metabolism and translation.
• Immunogen
  Amino acids EKEELMLVHSLEYIDLMETTQYMNEGELRVLAD of human HDAC6 were used as the immunogen for the HDAC6 antibody.
• Storage
  After reconstitution, the HDAC6 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  HDAC6  
• Gene symbol
  HDAC6
• Short name
  Anti-HDAC6
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to HDAC6
• Alternative technique
  antibodies
• Alternative to gene target
  histone deacetylase 6, CPBHM and HD6 and PPP1R90, HDAC6 and IDBG-63929 and ENSG00000094631 and 10013, NAD-dependent histone deacetylase activity (H3-K18 specific), nuclei, Hdac6 and IDBG-129835 and ENSMUSG00000031161 and 15185, BT.76413 and IDBG-636881 and ENSBTAG00000013244 and 513602

Gene info

• Identity
  HGNC:14064
• Gene
  HDAC6
• Long gene name
  histone deacetylase 6
• Synonyms
  • KIAA0901
  • JM21
  • HD6
  • FLJ16239
  • PPP1R90
• Synonyms name
  • protein phosphatase 1, regulatory subunit 90
• GenBank acession
  • AF132609
• Locus
  Xp11.23
• Discovery year
  2000-11-28
• Entrez gene record
  10013
• Pubmed identfication
  • 10220385
  • 10048485
• RefSeq identity
  • NM_006044
• Classification
  • Histone deacetylases, class IIB
  • Protein phosphatase 1 regulatory subunits
• VEGA ID
  OTTHUMG00000034496
• Locus Specific Databases
  • Global Variome shared LOVD

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products