FMRP Antibody / FMR1
-
Catalog numberR32195
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenFMRP / FMR1
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB
-
Recommended dilutionsWestern blot: 0.1-0.5ug/ml
-
NotesOptimal dilution of the FMRP antibody should be determined by the researcher.
-
Intented useThis FMRP antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotQ06787
-
PurityAntigen affinity
-
DescriptionFMR1 (fragile X mental retardation 1) is a human gene that codes for a protein called fragile X mental retardation protein, or FMRP. This protein, most commonly found in the brain, is essential for normalcognitive developmentand female reproductive function. Mutations of this gene can lead to fragile X syndrome, mental retardation, premature ovarian failure, autism, Parkinson's disease, developmental delays and other cognitive deficits. The protein encoded by this gene binds RNA and is associated with polysomes. Additionally, the encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1). Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.
-
ImmunogenAmino acids ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM of human FMRP were used as the immunogen for the FMRP antibody.
-
StorageAfter reconstitution, the FMRP antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolFMR1, FMR1-IT1, FMR1-AS1
-
Short nameAnti-FMRP / FMR1
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to FMRP / FMR1
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene nameFMRP translational regulator 1
-
Synonyms gene
-
Synonyms gene name
- premature ovarian failure 1
- fragile X mental retardation 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1992-01-17
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
-
Locus Specific Databases
Gene info
-
Identity
-
Gene
-
Long gene nameFMR1 intronic transcript 1
-
Synonyms gene name
- FMR1 intronic transcript 1 (non-protein coding)
-
Locus
-
Discovery year2011-05-19
-
Classification
- Intronic transcripts
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameFMR1 antisense RNA 1
-
Synonyms gene
-
Synonyms gene name
- FMR1 antisense RNA (non-protein coding)
- FMR1 antisense RNA 1 (non-protein coding)
- FMR1 antisense RNA 1 (head to head)
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year2010-10-05
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Antisense RNAs
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data