FABP4 Antibody

• Catalog number
  R31970
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  FABP4
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB, IHC-P
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
• Notes
  Optimal dilution of the FABP4 antibody should be determined by the researcher.
• Intented use
  This FABP4 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  P15090
• Purity
  Antigen affinity
• Description
  Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein, aP2 (FABP4) is expressed in adipocytes and macrophages, and integrates inflammatory and metabolic responses. Studies in aP2-deficient mice have shown that this lipid chaperone has a significant role in several aspects of metabolic syndrome, including type 2 diabetes and atherosclerosis. It regulates allergic airway inflammation and may provide a link between fatty acid metabolism and asthma.
• Immunogen
  Amino acids KLVSSENFDDYMKEVGVGFATRKVAGMAKPN of human FABP4 were used as the immunogen for the FABP4 antibody.
• Storage
  After reconstitution, the FABP4 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Localization
  Cytoplasmic
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  FABP4  
• Gene symbol
  FABP4
• Short name
  Anti-FABP4
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to FABP4
• Alternative technique
  antibodies
• Alternative to gene target
  fatty acid binding protein 4, adipocyte, A-FABP and AFABP and ALBP and aP2 and HEL-S-104, FABP4 and IDBG-26715 and ENSG00000170323 and 2167, fatty acid binding, nuclei, Fabp4 and IDBG-131207 and ENSMUSG00000062515 and 11770, FABP4 and IDBG-644862 and ENSBTAG00000037526 and 281759

Gene info

• Identity
  HGNC:3559
• Gene
  FABP4
• Long gene name
  fatty acid binding protein 4
• Synonyms
  • A-FABP
  • aP2
• Synonyms name
  • adipocyte fatty acid binding protein
• GenBank acession
  • J02874
• Locus
  8q21.13
• Discovery year
  1991-08-06
• Entrez gene record
  2167
• Pubmed identfication
  • 2481498
• RefSeq identity
  • NM_001442
• Classification
  • Fatty acid binding protein family
• VEGA ID
  OTTHUMG00000164602

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products