ERp57 Antibody / PDIA3

• Catalog number
  R32052
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  ERp57 / PDIA3
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB, IHC-P
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
• Notes
  Optimal dilution of the PDIA3 antibody should be determined by the researcher.
• Intented use
  This PDIA3 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  P30101
• Purity
  Antigen affinity
• Description
  PDIA3 (Protein disulfide isomerase family A, member 3), also called GRP58, Erp57 or ER60, is an isomerase enzyme. It is mapped on 15q15.3. PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex, which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface. This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates.
• Immunogen
  Amino acids RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL of human PDIA3/ERp57 were used as the immunogen for the PDIA3 antibody.
• Storage
  After reconstitution, the PDIA3 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Localization
  Cytoplasmic, membrane
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  ERp57   PDIA3  
• Gene symbol
  PDIA3
• Short name
  Anti-ERp57 / PDIA3
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to ERp57 / PDIA3
• Alternative technique
  antibodies
• Alternative to gene target
  protein disulfide isomerase family A, member 3, ER60 and ERp57 and ERp60 and ERp61 and GRP57 and GRP58 and HEL-S-269 and HEL-S-93n and HsT17083 and P58 and PI-PLC, PDIA3 and IDBG-9160 and ENSG00000167004 and 2923, poly(A) RNA binding, nuclei, Pdia3 and IDBG-202293 and ENSMUSG00000027248 and 14827, PDIA3 and IDBG-633244 and ENSBTAG00000017196 and 281803

Gene info

• Identity
  HGNC:4606
• Gene
  PDIA3
• Long gene name
  protein disulfide isomerase family A member 3
• Synonyms gene
  • GRP58
• Synonyms gene name
  • glucose regulated protein, 58kDa
  • protein disulfide isomerase-associated 3
  • protein disulfide isomerase family A, member 3
• Synonyms
  • P58
  • ERp61
  • ERp57
  • ERp60
  • GRP57
  • PI-PLC
  • HsT17083
• Locus
  15q15.3
• Discovery year
  1997-06-09
• Entrez gene record
  2923
• Pubmed identfication
  • 8974399
• RefSeq identity
  • NM_005313
• Classification
  • Protein disulfide isomerases
• VEGA ID
  OTTHUMG00000044444

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products