Cd46 Antibody

• Catalog number
  R31841
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  Cd46
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Mouse (Mus musculus) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml
• Notes
  Optimal dilution of the Cd46 antibody should be determined by the researcher.
• Intented use
  This Cd46 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  O88174
• Purity
  Antigen affinity
• Description
  CD46 complement regulatory protein,also known as CD46 (cluster of differentiation 46) andMembrane Cofactor Protein,is aproteinwhich in humans is encoded by the CD46 gene. The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. And the encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. Finally, the protein encoded by this gene may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations at this locus have been associated with susceptibility to hemolytic uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been described.
• Immunogen
  Amino acids ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK of mouse Cd46 were used as the immunogen for the Cd46 antibody.
• Storage
  After reconstitution, the Cd46 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  Cd46  
• Gene symbol
  CD46, CD46P1
• Short name
  Anti-Cd46
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to Cd46
• Alternative technique
  antibodies
• Alternative to gene target
  CD46 molecule, complement regulatory protein, AHUS2 and MCP and MIC10 and TLX and TRA2.10, CD46 and IDBG-106372 and ENSG00000117335 and 4179, cadherin binding, Cell surfaces, Cd46 and IDBG-209330 and ENSMUSG00000016493 and 17221, BT.68611 and IDBG-638462 and ENSBTAG00000005397 and 280851

Gene info

• Identity
  HGNC:6953
• Gene
  CD46
• Long gene name
  CD46 molecule
• Synonyms gene
  • MIC10
  • MCP
• Synonyms gene name
  • antigen identified by monoclonal antibody TRA-2-10
  • membrane cofactor protein (CD46, trophoblast-lymphocyte cross-reactive antigen)
  • CD46 antigen, complement regulatory protein
  • CD46 molecule, complement regulatory protein
• Synonyms
  • TRA2.10
  • MGC26544
  • TLX
• GenBank acession
  • BC030594
• Locus
  1q32.2
• Discovery year
  1988-08-31
• Entrez gene record
  4179
• Pubmed identfication
  • 7929741
• RefSeq identity
  • NM_172361
• Classification
  • Sushi domain containing
  • Complement system regulators and receptors
  • CD molecules
• VEGA ID
  OTTHUMG00000036397
• Locus Specific Databases
  • LRG_155

Gene info

• Identity
  HGNC:6959
• Gene
  CD46P1
• Long gene name
  CD46 molecule pseudogene 1
• Synonyms gene
  • MCPL
  • CD46P
• Synonyms gene name
  • membrane cofactor protein-like (CD46-like, trophoblast-lymphocyte cross-reactive antigen-like)
  • CD46 molecule, complement regulatory protein pseudogene
  • CD46 molecule, complement regulatory protein pseudogene 1
• GenBank acession
  • M73721
• Locus
  1q32.2
• Discovery year
  1992-06-05
• Entrez gene record
  4182
• Pubmed identfication
  • 1740338
• VEGA ID
  OTTHUMG00000036355

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products