ATG13 Antibody

• Catalog number
  R31833
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  ATG13
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml
• Notes
  Optimal dilution of the ATG13 antibody should be determined by the researcher.
• Intented use
  This ATG13 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  O75143
• Purity
  Antigen affinity
• Description
  Autophagy-related protein 13, also known as ATG13, is a protein that in humans is encoded by the KIAA0652 gene. ATG13 is an autophagy factor required for phagosome formation. It is located on 11p11.2. And ATG13 is a target of the TOR kinase signaling pathway that regulates autophagy through phosphorylation of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex.
• Immunogen
  Amino acids MAEDLDSLPEKLAVHEKNVREFDAFVETLQ of human ATG13 were used as the immunogen for the ATG13 antibody.
• Storage
  After reconstitution, the ATG13 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  ATG13  
• Gene symbol
  ATG13
• Short name
  Anti-ATG13
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to ATG13
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:29091
• Gene
  ATG13
• Long gene name
  autophagy related 13
• Synonyms gene
  • KIAA0652
• Synonyms gene name
  • KIAA0652
  • ATG13 autophagy related 13 homolog (S. cerevisiae)
• GenBank acession
  • AB014552
• Locus
  11p11.2
• Discovery year
  2005-10-28
• Entrez gene record
  9776
• Pubmed identfication
  • 15169610
  • 18339812
  • 17204848
• RefSeq identity
  • NM_014741
• Classification
  • Autophagy related
• VEGA ID
  OTTHUMG00000166538

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products