ARC Antibody / Activity-regulated cytoskeleton-associated protein

  • Catalog number
    R32271
  • Price
    Please ask
  • Size
    0.1mg
  • Category
    Antibody
  • Concentration
    0.5mg/ml if reconstituted with 0.2ml sterile DI water
  • Form
    Antigen affinity purified
  • Conjugation
    Unconjugated
  • Clone
    Polyclonal antibody
  • Recognised antigen
    ARC / Activity-regulated cytoskeleton-associated protein
  • Host animal
    Rabbit (Oryctolagus cuniculus)
  • Clonality
    Polyclonal (rabbit origin)
  • Species reactivity
    Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
  • Tested applications
    WB
  • Recommended dilutions
    Western blot: 0.1-0.5ug/ml
  • Notes
    Optimal dilution of the ARC antibody should be determined by the researcher.
  • Intented use
    This ARC antibodyis to be used only for research purposes and not for diagnostics..
  • Uniprot
    Q7LC44
  • Purity
    Antigen affinity
  • Description
    Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience.
  • Immunogen
    Amino acids KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA of human ARC were used as the immunogen for the ARC antibody.
  • Storage
    After reconstitution, the ARC antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
  • Properties
    If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
  • Gene symbol
    ARPC1B, ARC, ARPC3, ARPC4, NOL3, ARPC2, ARPC5
  • Short name
    Anti-ARC / Activity-regulated cytoskeleton-associated protein
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Isotype
    Rabbit IgG
  • Alternative name
    Antibodies to ARC / Activity-regulated cytoskeleton-associated protein
  • Alternative technique
    antibodies
  • Alternative to gene target
    activity-regulated cytoskeleton-associated protein, Arg3.1, ARC and IDBG-37634 and ENSG00000198576 and 23237, protein binding, Cell surfaces, Arc and IDBG-149967 and ENSMUSG00000022602 and 11838, ARC and IDBG-648018 and ENSBTAG00000021639 and 519403
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    actin related protein 2/3 complex subunit 3
  • Synonyms gene name
    • actin related protein 2/3 complex, subunit 3 (21 kD)
    • actin related protein 2/3 complex subunit 3, 21kDa
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1999-08-06
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Actin related protein 2/3 complex subunits
  • VEGA ID
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    nucleolar protein 3
  • Synonyms gene name
    • nucleolar protein 3 (apoptosis repressor with CARD domain)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1999-01-13
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Caspase recruitment domain containing
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    actin related protein 2/3 complex subunit 2
  • Synonyms gene name
    • actin related protein 2/3 complex, subunit 2 (34 kD)
    • actin related protein 2/3 complex subunit 2, 34kDa
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1999-08-06
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Actin related protein 2/3 complex subunits
  • VEGA ID
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee