AMHR2 Antibody
-
Catalog numberR32469
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenAMHR2
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB
-
Recommended dilutionsWestern blot: 0.5-1ug/ml
-
Added bufferLyophilized from 1X Phosphate Buffered Saline (PBS) with 2.5% BSA and 0.025% sodium azide
-
Intented useThis AMHR2 antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotQ16671
-
PurityAntigen affinity
-
DescriptionAMHR2 is the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified.
-
ImmunogenAmino acids QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE were used as the immunogen for the AMHR2 antibody.
-
StoragePrior to reconstitution, store at 4oC. After reconstitution, the AMHR2 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolAMHR2
-
Short nameAnti- AMHR2
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to AMHR2
-
Alternative techniqueantibodies
-
Alternative to gene targetanti-Mullerian hormone receptor, type II, AMHR and MISR2 and MISRII and MRII, AMHR2 and IDBG-36672 and ENSG00000135409 and 269, transforming growth factor beta receptor activity, Plasma membranes, Amhr2 and IDBG-188637 and ENSMUSG00000023047 and 110542, AMHR2 and IDBG-631327 and ENSBTAG00000018524 and
-
Gene info
-
Identity
-
Gene
-
Long gene nameanti-Mullerian hormone receptor type 2
-
Synonyms gene name
- anti-Mullerian hormone receptor type II
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1997-07-22
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Type 2 receptor serine/threonine kinases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data