AGO2 Antibody / Argonaute 2

• Catalog number
  R32463
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  AGO2 / Argonaute 2
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.5-1ug/ml
• Added buffer
  Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2.5% BSA and 0.025% sodium azide
• Intented use
  This AGO2 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  Q9UKV8
• Purity
  Antigen affinity
• Description
  Protein argonaute-2, also known as AGO2, is a protein that in humans is encoded by the EIF2C2 gene. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.
• Immunogen
  Amino acids KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL from the human protein were used as the immunogen for the AGO2 antibody.
• Storage
  Prior to reconstitution, store at 4oC. After reconstitution, the AGO2 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  AGO2   Argonaute  
• Gene symbol
  AGO2
• Short name
  Anti- AGO2 / Argonaute 2
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to AGO2 / Argonaute 2
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:3263
• Gene
  AGO2
• Long gene name
  argonaute RISC catalytic component 2
• Synonyms gene
  • EIF2C2
  • CASC7
• Synonyms gene name
  • eukaryotic translation initiation factor 2C, 2
  • cancer susceptibility candidate 7 (non-protein coding)
• Synonyms
  • hAGO2
  • Q10
  • LINC00980
• Synonyms name
  • argonaute 2
• GenBank acession
  • AF121255
• Locus
  8q24.3
• Discovery year
  2000-01-14
• Entrez gene record
  27161
• Pubmed identfication
  • 10534406
  • 12906857
• RefSeq identity
  • NM_012154
• Classification
  • Argonaute RISC component family
  • RISC loading complex
  • Endoribonucleases
• VEGA ID
  OTTHUMG00000164232

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products