HIV-2 gp41 Antigenic Peptide 5

  • Catalog number
    MBS658397
  • Price
    3194.04 USD
  • Size
    5x1 mg
  • Products_type
    Peptide
  • Products_short_name
    [HIV-2 gp41 Antigenic Peptide 5]
  • Products_name_syn
    [HIV-2 gp41 Antigenic Peptide 5 (RVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDS-NH2)]
  • Reactivity
    Human
  • Purity
    Highly Purified~95%. Purified by HPLC.
  • Form
    Supplied as a lyophilized powder.
  • Storage_stability
    Lyophilized powder may be stored at 4 degree C for short-term only. Stable for 12 months at -20 degree C. Reconstitute to nominal volume (see reconstitution instructions for peptides) and store at -20 degree C. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer._x000B_ _x000B_
  • Gene
    The human immunodeficiency virus (HIV) is a lentivirus (a subgroup of retrovirus) that causes HIV infection and over time acquired immunodeficiency syndrome(AIDS). AIDS is a condition in humans in which progressive failure of the immune system allows life-threatening opportunistic infections and cancers to thrive. Without treatment, average survival time after infection with HIV is estimated to be 9 to 11 years, depending on the HIV subtype. Infection with HIV occurs by the transfer of blood, semen, vaginal fluid, pre-ejaculate, or breast milk. Within these bodily fluids, HIV is present as both free virus particles and virus within infected immune cells. recombinant HIV 1 and 2 gag gene proteins p24, p17, p55 immunodominant epitopes and envelope glycoproteins, gp120 are used for production of diagnostic detection antibodies.
  • Description
    Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
  • Gene target
    HIV-2   gp41   Antigenic   Peptide  
  • Gene symbol
    HIVEP2, MIR7-2, MIR329-2, MIR512-2, MIR521-2, MIR1289-2, MIR509-2, KRTAP13-2, RNU6-2, SNORD116-2
  • Short name
    HIV-2 gp41 Antigenic Peptide 5
  • Technique
    peptide, peptides
  • Host
    Synthetic peptide
  • Alternative name
    human immunodeficiency virus-2 gp41 Antigenic short protein sequence 5
  • Alternative technique
    peptides
  • Virus
    hiv
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee