PAb (IgG) to Bovine PGIS / PTGIS

  • Catalog number
    MBS241628
  • Price
    Please ask
  • Size
    50ug
  • Alternative name1
    Anti-Rabbit Polyclonal (IgG) to Bovine PGIS / PTGIS
  • Alternative name2
    Rabbit PAb (IgG) to Bovine PGIS / PTGIS
  • Alternative name3
    Lapin Polyclonal (IgG) to Bovinae PGIS / PTGIS
  • Alternative name4
    PGIS / PTGIS
  • Alternative name5
    Anti-PGIS / PTGIS Antibody (aa299-329) IHC-plus; PTGIS; CYP8A1; Prostaglandin I2 synthase; Prostacyclin synthase; PTGI; CYP8; PGIS; Bovine PGIS; PTGIS
  • Other names
    prostacyclin synthase; Prostacyclin synthase; prostacyclin synthase; prostaglandin I2 synthase; cytochrome P450, family 8, subfamily A, polypeptide 1; prostaglandin I2 (prostacyclin) synthase; Prostaglandin I2 synthase
  • Gene name
    PGIS
  • Gene name synonims
    PTGIS
  • Other gene names
    PTGIS; PTGIS; CYP8; PGIS; PTGI; CYP8A1; CYP8; CYP8A1
  • Category
    Antibodies
  • Clonality
    Polyclonal
  • Immunoglobulin isotype
    IgG
  • Clone
    Polyclonal antibody
  • Host organism
    Rabbit
  • Species reactivity
    Bovine, Human
  • Specificity and cross reactivity
    Bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)1,2,3
  • Purification method
    Immunoaffinity Purified
  • Form Appearance
    TBS, pH 7.4, 0.5% BSA, 0.02% sodium azide, 50% glycerol.
  • Concentration
    0.2 mg/ml
  • Storage and shipping
    Long term: Store productone at -20 degrees Celsius.; Short term: +Store productone at +4 degrees Celsius.. Avoid repeat freeze-thaw cycles.
  • Tested for
    Immunohistochemistry (IHC - Paraffin), Western Blot (WB), Immunoprecipitation (IP)
  • Description
    productone is a polyclonal antibody of high purity and binding affinity for the antigen that it is risen against. Properly used, this antibody will ensure excellent and reproducible results with guaranteed success for the applications that it is tested in. Polyclonal antibodies have series of advantages - larger batches can be supplied at a time, they are inexpensive to manufacture and respectively to buy, the time needed for production is considerably shorter. Polyclonal antibodies generally are more stable and retain their reactivity under unfavorable conditions. To obtain more detailed information on productone, please, refer to the full product datasheet.
  • Advisory
    In order to retain the quality and the affinity of productone unchanged, please, avoid cycles of freezing and thawing. For antibodies that are in liquid form or reconstituted lyophilized antibodies small amounts could become entrapped on the seal or the walls of the tube. Prior to use briefly centrifuge the vial to gather all the solution on the bottom.
  • About
    Immunoglobulin gamma, IgG, mouse monoclonal H&L chain clones or rabbit, goat polyclonal antibodies have 4 parts. There are 2 heavy chains, 2 light chains. The IgG antibody has 2 antigen binding sites. They represent 70% or more of serum antibodies. This antibody can be antigen purified or protein A or G purified. For storage sodium azide is added or you can call us to request azide free antibody preparations. These will need colder storage temperatures.
  • Gene target
    PAb   PGIS   PTGIS  
  • Gene symbol
    PTGIS
  • Short name
    PAb (IgG) PGIS / PTGIS
  • Technique
    IgG, IgGs
  • Isotype
    IgG, IgG
  • Species
    Bovine, Bos Taurus genes are available form the Bovine Genome database.
  • Alternative name
    polyclonal (Immunoglobulin G) to Bovine PGIS / prostaglandin I2 (prostacyclin) synthase
  • Alternative technique
    immunoglobulins
  • Alternative to gene target
    prostaglandin I2 (prostacyclin) synthase, CYP8 and CYP8A1 and PGIS and PTGI, PTGIS and IDBG-80513 and ENSG00000124212 and 5740, oxidoreductase activity, nuclei, Ptgis and IDBG-213024 and ENSMUSG00000017969 and 19223, PTGIS and IDBG-643178 and ENSBTAG00000017537 and 101910090,282021
Gene info
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee