Min length of search pharse is two chars

Filters

Recombinant Aspergillus niger Aspergillopepsin-2

  • Catalog number
    RPC20396
  • Product name
    Recombinant Aspergillus niger Aspergillopepsin-2
  • Size
    1 mg
  • Price
    1880.26
  • Supplier
    bioma
  • Verified reactivity
    Aspergillus niger
  • Protein number
    P24665 
  • Gene number
    Please refer to GenBank
  • Other name
    Acid protease A; Aspergillopepsin II; Proctase A
  • Protein origin
    E.coli
  • Protein region
    60-98aa
  • Protein sequence
    EEYSSNWAGAVLIGDGYTKVTGEFTVPSVSAGSSGSSGY
  • Information about sequence
    Full Length
  • Expected molecular weight
    20.4kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Aspergillus niger Aspergillopepsin-2
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative name
    recombinant Aspergillus niger Aspergillopepsin-2
  • Alternative technique
    rec
MeSH Data
  • Name
  • Concept
    Scope note:The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    classification, economics, history, instrumentation, methods, standards, trends, utilization, veterinary, statistics & numerical data, ethics
Additional information
Related products
Chat with gentaur.com employee