Min length of search pharse is two chars

Filters

Recombinant Bovine Resistin(RETN)

  • Catalog number
    RPC20072
  • Product name
    Recombinant Bovine Resistin(RETN)
  • Size
    500 μg
  • Price
    1 267.62 USD
  • Supplier
  • Verified reactivity
    Bos taurus (Bovine)
  • Protein number
    Q762I5
  • Gene number
    RETN
  • Other name
    no alternative name
  • Protein origin
    E.coli
  • Protein region
    19-109aa
  • Protein sequence
    QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLHIQ
  • Information about sequence
    Full Length
  • Expected molecular weight
    13.7kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Resistin(RETN)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Bovine, Bos Taurus genes are available form the Bovine Genome database.
  • Alternative name
    recombinant Bovine Resistin(resistin)
  • Alternative technique
    rec
  • Alternative to gene target
    resistin, RETN and IDBG-23228 and ENSG00000104918 and 56729, this GO :0005179 and hormone activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0007568 and aging and biological process this GO :0008150 and biological process and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0010714 and positive regulation of collagen metabolic process and biological process this GO :0014911 and positive regulation of smooth muscle cell migration and biological process this GO :0032868 and response to insulin and biological process this GO :0045444 and fat cell differentiation and biological process this GO :0048661 and positive regulation of smooth muscle cell proliferation and biological process this GO :0050806 and positive regulation of synaptic transmission and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :2000252 and negative regulation of feeding behavior and biological process this GO :2000872 and positive regulation of progesterone secretion and biological process, hormone activity, this GO :0005179: hormone activity, this GO :0005179: hormone activity, nuclei, Retn and IDBG-130350 and ENSMUSG00000012705 and 57264, RETN and IDBG-643684 and ENSBTAG00000004716 and 369020
1. Gene info
MeSH Data
  • Name
  • Concept
    Scope note:The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    classification, economics, history, instrumentation, methods, standards, trends, utilization, veterinary, statistics & numerical data, ethics
Additional information
Related products
Chat with gentaur.com employee