STAU1 Antibody / Staufen

• Catalog number
  R31848
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  STAU1 / Staufen
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml
• Notes
  Optimal dilution of the STAU1 antibody should be determined by the researcher.
• Intented use
  This STAU1 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  O95793
• Purity
  Antigen affinity
• Description
  Double-stranded RNA-binding protein Staufen homolog 1 is a protein that in humans is encoded by the STAU1 gene. Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation. Five transcript variants resulting from alternative splicing of STAU gene and encoding three isoforms have been described. Three of these variants encode the same isoform, however, differ in their 5'UTR.
• Immunogen
  Amino acids HGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGN of human Staufen were used as the immunogen for the STAU1 antibody.
• Storage
  After reconstitution, the STAU1 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Localization
  Cytoplasmic
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  STAU1   Staufen  
• Gene symbol
  STAU1
• Short name
  Anti-STAU1 / Staufen
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to STAU1 / Staufen
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:11370
• Gene
  STAU1
• Long gene name
  staufen double-stranded RNA binding protein 1
• Synonyms gene
  • STAU
• Synonyms gene name
  • staufen (Drosophila, RNA-binding protein)
  • staufen, RNA binding protein (Drosophila)
  • staufen, RNA binding protein, homolog 1 (Drosophila)
• Synonyms
  • PPP1R150
• Synonyms name
  • protein phosphatase 1, regulatory subunit 150
• Locus
  20q13.13
• Discovery year
  1996-04-22
• Entrez gene record
  6780
• Pubmed identfication
  • 8884277
  • 15680326
• RefSeq identity
  • NM_017453
• Classification
  • Protein phosphatase 1 regulatory subunits
• VEGA ID
  OTTHUMG00000032691

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products