STAT6 Antibody
-
Catalog numberPB9405
-
PricePlease ask
-
Size0,1 mg
-
-
Target antigenSTAT6
-
ClonalityPolyclonal antibody
-
ClonePolyclonal antibody
-
Raised inrabbit
-
Type of the antibodyIgG polyclonal antibody
-
Product formfreeze-dried
-
Reacts with specieshuman, mouse, rat
-
AnalysesWB
-
ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human STAT6(85-115aa ESIYQRDPLKLVATFRQILQGEKKAVMEQFR), different from the related mouse sequence by three amino acids.
-
Product configurationEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
PurificationImmunogen affinity purified.
-
SolubilizationThe powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtionsKeep the STAT6 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
TipsThe STAT6 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
BackgroundSTAT6 is a human gene. The protein encoded by this gene is a member of the STAT family of transcription factors. The gene spans 19 kb and contains 23 exons. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2), expression of cell surface markers, and class switch of immunoglobulins.
-
Related articles1. Dickensheets, H. L., Venkataraman, C., Schindler, U., Donnelly, R. P.Interferons inhibit activation of STAT6 by interleukin 4 in human monocytes by inducing SOCS-1 gene expression.Proc. Nat. Acad. Sci. 96: 10800-10805, 1999. 2. Duetsch, G., Illig, T., Loesgen, S., Rohde, K., Kloop, N., Herbon, N., Cohlke, H., Altmueller, J., Wjst, M.STAT6 as an asthma candidate gene: polymorphism-screening, association and haplotype analysis in a Caucasian sib-pair study.Hum. Molec. Genet. 11: 613-621, 2002. 3. Mullings, R. E., Wilson, S. J., Puddicombe, S. M., Lordan, J. L., Bucchieri, F., Djukanovic, R., Howarth, P. H., Harper, S., Holgate, S. T., Davies, D. E.Signal transducer and activator of transcription 6 (STAT-6) expression and function in asthmatic bronchial epithelium.J. Allergy Clin. Immun. 108: 832-838, 2001.
-
Gene NameSTAT6
-
Protein NameSignal transducer and activator of transcription 6
-
Gene Full Namesignal transducer and activator of transcription 6, interleukin-4 induced
-
SynonymsD12S1644 antibody|IL 4 STAT antibody|IL-4 Stat antibody|IL4 STAT antibody|Interleukin 4 Induced antibody|Interleukin 4 Induced Transcription Factor IL4 STAT antibody|Signal transducer and activator of transcription 6 antibody|Signal Transducer And Activator Of Transcription 6 Interleukin 4 Induced antibody|Signal Transducer And Activator Of Transcription 6 Nirs Variant 1 antibody|Signal transducer and activator of transcription 6, interleukin 4 induced antibody|STAT 6 antibody|STAT interleukin4 induced antibody|STAT, interleukin4 induced antibody|Stat6 antibody|STAT6_HUMAN antibody|STAT6B antibody|STAT6C antibody|Transcription factor IL 4 STAT antibody
-
Uniprot IDP42226
-
Entrez GeneID6778
-
PropertiesIf you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolSTAT6
-
Short nameSTAT6 Antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative namesignal transducer and activator on transcription 6, interleukin-4 induced (antibody to-)
-
Alternative techniqueantibodies
-
Alternative to gene targetsignal transducer and activator of transcription 6, interleukin-4 induced, D12S1644 and IL-4-STAT and STAT6B and STAT6C, STAT6 and IDBG-42122 and ENSG00000166888 and 6778, sequence-specific DNA binding, nuclei, Stat6 and IDBG-195602 and ENSMUSG00000002147 and 20852, STAT6 and IDBG-635695 and ENSBTAG00000006335 and 353105
-
Gene info
-
Identity
-
Gene
-
Long gene namesignal transducer and activator of transcription 6
-
Synonyms gene name
- signal transducer and activator of transcription 6, interleukin-4 induced
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1995-11-09
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- SH2 domain containing
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data