STAT6 Antibody

  • Catalog number
    PB9405
  • Price
    Please ask
  • Size
    0,1 mg
  • Target antigen
    STAT6
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    human, mouse, rat
  • Analyses
    WB
  • Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of human STAT6(85-115aa ESIYQRDPLKLVATFRQILQGEKKAVMEQFR), different from the related mouse sequence by three amino acids.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the STAT6 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The STAT6 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    STAT6 is a human gene. The protein encoded by this gene is a member of the STAT family of transcription factors. The gene spans 19 kb and contains 23 exons. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2), expression of cell surface markers, and class switch of immunoglobulins.
  • Related articles
    1. Dickensheets, H. L., Venkataraman, C., Schindler, U., Donnelly, R. P.Interferons inhibit activation of STAT6 by interleukin 4 in human monocytes by inducing SOCS-1 gene expression.Proc. Nat. Acad. Sci. 96: 10800-10805, 1999. 2. Duetsch, G., Illig, T., Loesgen, S., Rohde, K., Kloop, N., Herbon, N., Cohlke, H., Altmueller, J., Wjst, M.STAT6 as an asthma candidate gene: polymorphism-screening, association and haplotype analysis in a Caucasian sib-pair study.Hum. Molec. Genet. 11: 613-621, 2002. 3. Mullings, R. E., Wilson, S. J., Puddicombe, S. M., Lordan, J. L., Bucchieri, F., Djukanovic, R., Howarth, P. H., Harper, S., Holgate, S. T., Davies, D. E.Signal transducer and activator of transcription 6 (STAT-6) expression and function in asthmatic bronchial epithelium.J. Allergy Clin. Immun. 108: 832-838, 2001.
  • Gene Name
    STAT6
  • Protein Name
    Signal transducer and activator of transcription 6
  • Gene Full Name
    signal transducer and activator of transcription 6, interleukin-4 induced
  • Synonyms
    D12S1644 antibody|IL 4 STAT antibody|IL-4 Stat antibody|IL4 STAT antibody|Interleukin 4 Induced antibody|Interleukin 4 Induced Transcription Factor IL4 STAT antibody|Signal transducer and activator of transcription 6 antibody|Signal Transducer And Activator Of Transcription 6 Interleukin 4 Induced antibody|Signal Transducer And Activator Of Transcription 6 Nirs Variant 1 antibody|Signal transducer and activator of transcription 6, interleukin 4 induced antibody|STAT 6 antibody|STAT interleukin4 induced antibody|STAT, interleukin4 induced antibody|Stat6 antibody|STAT6_HUMAN antibody|STAT6B antibody|STAT6C antibody|Transcription factor IL 4 STAT antibody
  • Uniprot ID
    P42226
  • Entrez GeneID
    6778
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    STAT6  
  • Gene symbol
    STAT6
  • Short name
    STAT6 Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    signal transducer and activator on transcription 6, interleukin-4 induced (antibody to-)
  • Alternative technique
    antibodies
  • Alternative to gene target
    signal transducer and activator of transcription 6, interleukin-4 induced, D12S1644 and IL-4-STAT and STAT6B and STAT6C, STAT6 and IDBG-42122 and ENSG00000166888 and 6778, sequence-specific DNA binding, nuclei, Stat6 and IDBG-195602 and ENSMUSG00000002147 and 20852, STAT6 and IDBG-635695 and ENSBTAG00000006335 and 353105
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee