-
Target antigen
PIGR
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, rat
-
Analyses
WB
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PIGR (579-613aa DAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVAD), different from the related rat sequence by eighteen amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the PIGR Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The PIGR Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Polymeric immunoglobulin receptor is a protein that in humans is encoded by the PIGR gene. It is a Fc receptor which facilitates the secretion of the soluble polymeric isoforms of immunoglobulin A and immunoglobulin M. This gene is mapped to 1q31-q41. The encoded poly-Ig receptor binds polymeric immunoglobulin molecules at the basolateral surface of epithelial cells; the complex is then transported across the cell to be secreted at the apical surface. A significant association was found between immunoglobulin A nephropathy and several SNPs in this gene.
-
Related articles
1. "Entrez Gene: PIGR polymeric immunoglobulin receptor". 2. Hood L, Kronenberg M, Hunkapiller T (Feb 1985). "T cell antigen receptors and the immunoglobulin supergene family". Cell 40 (2): 225–9. 3. Kaetzel CS (Aug 2005). "The polymeric immunoglobulin receptor: bridging innate and adaptive immune responses at mucosal surfaces". Immunological Reviews 206: 83–99.
-
Gene Name
PIGR
-
Protein Name
Polymeric immunoglobulin receptor
-
Gene Full Name
polymeric immunoglobulin receptor
-
Synonyms
Hepatocellular carcinoma associated protein TB6 antibody|Hepatocellular carcinoma-associated protein TB6 antibody|MGC125361 antibody| MGC125362 antibody|Phosphatidylinositol glycan, class R antibody|PIGR antibody|PIGR_HUMAN antibody|Poly Ig receptor antibody|Poly-Ig receptor antibody|Polymeric immunoglobulin receptor antibody|Secretory component antibody|Transmembrane secretory component antibody
-
Uniprot ID
P01833
-
Entrez GeneID
5284
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
