NQO1 Antibody

• Catalog number
  R31977
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  NQO1
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml
• Notes
  Optimal dilution of the NQO1 antibody should be determined by the researcher.
• Intented use
  This NQO1 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  P15559
• Purity
  Antigen affinity
• Description
  This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. And this FAD-binding protein forms homodimers and reduces quinones to hydroquinones. In addition, this protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Immunogen
  Amino acids EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK of human NQO1 were used as the immunogen for the NQO1 antibody.
• Storage
  After reconstitution, the NQO1 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  NQO1  
• Gene symbol
  NQO1-DT, NQO1
• Short name
  Anti-NQO1
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to NQO1
• Alternative technique
  antibodies
• Alternative to gene target
  NAD(P)H dehydrogenase, quinone 1, DHQU and DIA4 and DTD and NMOR1 and NMORI and QR1, NQO1 and IDBG-39427 and ENSG00000181019 and 1728, cytochrome-b5 reductase activity, Cytoplasm, Nqo1 and IDBG-190808 and ENSMUSG00000003849 and 18104, NQO1 and IDBG-634590 and ENSBTAG00000020632 and 519632

Gene info

• Identity
  HGNC:55344
• Gene
  NQO1-DT
• Long gene name
  NQO1 divergent transcript
• Locus
  16q22.1
• Discovery year
  2020-11-04
• Classification
  • Divergent transcripts

Gene info

• Identity
  HGNC:2874
• Gene
  NQO1
• Long gene name
  NAD(P)H quinone dehydrogenase 1
• Synonyms gene
  • NMOR1
  • DIA4
• Synonyms gene name
  • diaphorase (NADH/NADPH) (cytochrome b-5 reductase)
  • NAD(P)H dehydrogenase, quinone 1
• Synonyms
  • DHQU
  • QR1
  • DTD
• GenBank acession
  • M81600
• Locus
  16q22.1
• Discovery year
  2001-06-22
• Entrez gene record
  1728
• Pubmed identfication
  • 2843525
• VEGA ID
  OTTHUMG00000137575

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products