APRIL Antibody
-
Catalog numberR31837
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenAPRIL
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB, ELISA
-
Recommended dilutionsWestern blot: 0.1-0.5ug/ml,ELISA : 0.1-0.5ug/ml
-
NotesOptimal dilution of the APRIL antibody should be determined by the researcher.
-
Intented useThis APRIL antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotO75888
-
PurityAntigen affinity
-
DescriptionA proliferation-inducing ligand (APRIL), also known as tumor necrosis factor ligand superfamily member 13 (TNFSF13), is a protein of the TNF superfamily recognized by the cell surface receptor TACI. The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. And this protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Alternative splicing results in multiple transcript variants. Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13.
-
ImmunogenAmino acids PINATSKDDSDVTEVMWQPALRRGRGLQAQ of human APRIL were used as the immunogen for the APRIL antibody.
-
StorageAfter reconstitution, the APRIL antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolTNFSF13, ANP32B
-
Short nameAnti-APRIL
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to APRIL
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene nameTNF superfamily member 13
-
Synonyms gene name
- tumor necrosis factor (ligand) superfamily, member 13
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-12-04
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Tumor necrosis factor superfamily
- CD molecules
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameacidic nuclear phosphoprotein 32 family member B
-
Synonyms gene name
- acidic (leucine-rich) nuclear phosphoprotein 32 family, member B
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2002-02-13
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- ANP32 acidic nuclear phosphoproteins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
