YWHAZ Blocking Peptide

• Catalog number
  33R-2862
• Price
  Please ask
• Size
  100 µg

• Category
  Proteins
• Antibody Subtype
  Blocking Peptides
• Area of research
  Signal Transduction
• Residues
  FDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
• Type of protein
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• URL
• More info
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  YWHAZ  
• Gene symbol
  YWHAZ
• Short name
  YWHAZ Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  A synthetic peptide for use as a blocking control in assays to test for specificity of YWHAZ antibody, catalog no. 70R-3632
• Alternative technique
  control, peptides
• Alternative to gene target
  tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide, 14-3-3-zeta and HEL-S-3 and HEL4 and KCIP-1 and YWHAD, YWHAZ and IDBG-30919 and ENSG00000164924 and 7534, poly(A) RNA binding, nuclei, Ywhaz and IDBG-135418 and ENSMUSG00000022285 and 102641764,22631, YWHAZ and IDBG-645101 and ENSBTAG00000000236 and 287022

Gene info

• Identity
  HGNC:12855
• Gene
  YWHAZ
• Long gene name
  tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta
• Synonyms gene
  • YWHAD
• Synonyms gene name
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
• Synonyms
  • KCIP-1
  • 14-3-3-zeta
• Synonyms name
  • 14-3-3 zeta
  • 14-3-3 delta
• GenBank acession
  • U28964
• Locus
  8q22.3
• Discovery year
  1993-09-20
• Entrez gene record
  7534
• Pubmed identfication
  • 8617504
  • 7890696
• RefSeq identity
  • NM_145690
• Classification
  • 14-3-3 phospho-serine/phospho-threonine binding proteins
• VEGA ID
  OTTHUMG00000134291

Similar products