VDAC1 antibody
-
Catalog number70R-1541
-
PricePlease ask
-
Size100 µg
-
-
CategoryPrimary Antibody
-
Antibody SubtypePolyclonal Antibodies, Purified
-
Area of researchCell Biology
-
Type of ImmunogenVDAC1 antibodies were raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
-
Raised inRabbit
-
SpecificityVDAC1 antibody was raised against the C terminal of VDAC1
-
Cross ReactivityHuman, Mouse, Rat, Dog
-
Method of PurificationTotal IgG Protein A purified
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of VDAC1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping conditionsBlue Ice
-
Tested forWB; IHC
-
Usage RecommendationsWB: 1.25 ug/ml; IHC: 4-8 ug/ml
-
Assay InformationVDAC1 Blocking Peptide, catalog no. 33R-8303, is also available for use as a blocking control in assays to test for specificity of this VDAC1 antibody
-
Additional InformationThis is a rabbit polyclonal antibody against VDAC1. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolVDAC1
-
Short nameVDAC1 antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameRabbit polyclonal VDAC1 antibody raised against the C terminal of VDAC1
-
Alternative techniqueantibodies
-
Alternative to gene targetvoltage-dependent anion channel 1, PORIN and VDAC-1, VDAC1 and IDBG-240337 and ENSG00000213585 and 7416, porin activity, nuclei, Vdac1 and IDBG-171107 and ENSMUSG00000020402 and 22333, VDAC1 and IDBG-645740 and ENSBTAG00000013113 and 282119
-
Gene info
-
Identity
-
Gene
-
Long gene namevoltage dependent anion channel 1
-
Synonyms
-
Locus
-
Discovery year1993-11-02
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Voltage dependent anion channels
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data