TLR8 antibody
-
Catalog number70R-14932
-
PricePlease ask
-
Size200 µg
-
-
CategoryPrimary Antibody
-
Antibody SubtypePolyclonal Antibodies, Purified
-
Area of researchSignal Transduction
-
Type of ImmunogenTLR8 antibodies were raised in Goat using 30 amino acid (aa)synthetic peptide CESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-terminal domain of Human TLR8 .
-
Raised inGoat
-
Method of PurificationTLR8 antibody was purified by affinity chromatography
-
Concentration1 mg/ml
-
Form BufferProvided in 10 mM KHPO4, 140 mM NaCl with 0.1 % NaN3
-
StorageAliquot and freeze at -20 deg C. Avoid freeze-thaw cycles
-
Shipping conditionsBlue Ice
-
Tested forIHC; WB
-
Usage RecommendationsIHC: 1:125, WB: 1:500
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolTLR8-AS1, TLR8
-
Short nameTLR8 antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameAffinity purified goat polyclonal TLR8 antibody
-
Alternative techniqueantibodies
-
Alternative to gene targettoll-like receptor 8, TLR8 and IDBG-44288 and ENSG00000101916 and 51311, drug binding, Plasma membranes, Tlr8 and IDBG-185523 and ENSMUSG00000040522 and 170744
-
Gene info
-
Identity
-
Gene
-
Long gene nameTLR8 antisense RNA 1
-
Synonyms gene name
- TLR8 antisense RNA 1 (non-protein coding)
-
Locus
-
Discovery year2011-07-29
-
Entrez gene record
-
Classification
- Antisense RNAs
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nametoll like receptor 8
-
Synonyms gene name
- toll-like receptor 8
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2001-04-27
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Toll like receptors
- CD molecules
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data