TLR8 antibody

  • Catalog number
    70R-14932
  • Price
    Please ask
  • Size
    200 µg
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Area of research
    Signal Transduction
  • Type of Immunogen
    TLR8 antibodies were raised in Goat using 30 amino acid (aa)synthetic peptide CESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-terminal domain of Human TLR8 .
  • Raised in
    Goat
  • Method of Purification
    TLR8 antibody was purified by affinity chromatography
  • Concentration
    1 mg/ml
  • Form Buffer
    Provided in 10 mM KHPO4, 140 mM NaCl with 0.1 % NaN3
  • Storage
    Aliquot and freeze at -20 deg C. Avoid freeze-thaw cycles
  • Shipping conditions
    Blue Ice
  • Tested for
    IHC; WB
  • Usage Recommendations
    IHC: 1:125, WB: 1:500
  • URL
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    TLR8  
  • Gene symbol
    TLR8-AS1, TLR8
  • Short name
    TLR8 antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    Affinity purified goat polyclonal TLR8 antibody
  • Alternative technique
    antibodies
  • Alternative to gene target
    toll-like receptor 8, TLR8 and IDBG-44288 and ENSG00000101916 and 51311, drug binding, Plasma membranes, Tlr8 and IDBG-185523 and ENSMUSG00000040522 and 170744
Gene info
  • Identity
  • Gene
  • Long gene name
    TLR8 antisense RNA 1
  • Synonyms gene name
    • TLR8 antisense RNA 1 (non-protein coding)
  • Locus
  • Discovery year
    2011-07-29
  • Entrez gene record
  • Classification
    • Antisense RNAs
  • VEGA ID
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee