TIA1 Blocking Peptide

• Catalog number
  33R-6040
• Price
  Please ask
• Size
  100 µg

• Category
  Proteins
• Antibody Subtype
  Blocking Peptides
• Area of research
  Cell Cycle & Cell Death
• Residues
  MGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTED
• Type of protein
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• URL
• More info
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  TIA1  
• Gene symbol
  TIA1
• Short name
  TIA1 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  A synthetic peptide for use as a blocking control in assays to test for specificity of TIA1 antibody, catalog no. 70R-5035
• Alternative technique
  control, peptides
• Alternative to gene target
  TIA1 cytotoxic granule-associated RNA binding protein, TIA-1 and WDM, TIA1 and IDBG-55200 and ENSG00000116001 and 7072, poly(A) RNA binding, nuclei, Tia1 and IDBG-164670 and ENSMUSG00000071337 and 21841, TIA1 and IDBG-635927 and ENSBTAG00000019182 and 538533

Gene info

• Identity
  HGNC:11802
• Gene
  TIA1
• Long gene name
  TIA1 cytotoxic granule associated RNA binding protein
• Synonyms gene name
  • TIA1 cytotoxic granule-associated RNA-binding protein
• Synonyms
  • TIA-1
• Synonyms name
  • T-cell-restricted intracellular antigen-1
  • nucleolysin TIA-1 isoform p40
• Locus
  2p13.3
• Discovery year
  1995-11-01
• Entrez gene record
  7072
• Pubmed identfication
  • 8176212
  • 12486009
• RefSeq identity
  • NM_022037
• Classification
  • RNA binding motif containing
• VEGA ID
  OTTHUMG00000129644

Similar products