Thymopoietin antibody
-
Catalog number70R-6297
-
PricePlease ask
-
Size50 µg
-
-
CategoryPrimary Antibody
-
Antibody SubtypePolyclonal Antibodies, Purified
-
Area of researchImmunology
-
Type of ImmunogenThymopoietin antibodies were raised using the N terminal of TMPO corresponding to a region with amino acids MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR
-
Raised inRabbit
-
SpecificityThymopoietin antibody was raised against the N terminal of TMPO
-
Cross ReactivityHuman,Mouse,Rat
-
Method of PurificationAffinity purified
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMPO antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping conditionsBlue Ice
-
Tested forWB
-
Usage RecommendationsWB: 1 ug/ml
-
Assay InformationThymopoietin Blocking Peptide, catalog no. 33R-6275, is also available for use as a blocking control in assays to test for specificity of this Thymopoietin antibody
-
Additional InformationThis is a rabbit polyclonal antibody against TMPO, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
GeneThymopoietin I and II are proteins involved in the induction of CD90 in the thymus. The thymopoetin (TMPO) gene encodes three alternatively spliced mRNAs encoding proteins of 75 kDa (alpha), 51 kDa (beta) and 39 kDa (gamma) which are ubiquitously expressed in all cells. The human TMPO gene maps to chromosome band 12q22 and consists of eight exons. TMPO alpha is present diffusely expressed with the cell nucleus while TMPO beta and gamma are localized to the nuclear membrane. TMPO beta is a human homolog of the murine protein LAP2. LAP2 plays a role in the regulation of nuclear architecture by binding lamin B1 and chromosomes. This interaction is regulated by phosphorylation during mitosis. Given the nuclear localization of the three TMPO isoforms, it is unlikely that these proteins play any role in CD90 induction.
-
French translationanticorps
-
Gene target
-
Gene symbolTMPOP1, TMPOP2, TMPO
-
Short nameThymopoietin antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameRabbit polyclonal Thymopoietin antibody raised against the N terminal of TMPO
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene namethymopoietin pseudogene 1
-
Synonyms gene
-
Synonyms gene name
- thymopoietin-like 1
-
Synonyms
-
Locus
-
Discovery year2003-11-27
-
Entrez gene record
-
RefSeq identity
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namethymopoietin pseudogene 2
-
Synonyms gene name
- thymopoietin pseudogene 2 (functional)
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year2014-07-06
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namethymopoietin
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year1994-11-08
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- LEM domain containing
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data