SH2D3C antibody

• Catalog number
  70R-5771
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Signal Transduction
• Type of Immunogen
  SH2D3C antibodies were raised using the N terminal of SH2D3C corresponding to a region with amino acids AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE
• Raised in
  Rabbit
• Specificity
  SH2D3C antibody was raised against the N terminal of SH2D3C
• Cross Reactivity
  Human,Mouse,Rat
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SH2D3C antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  SH2D3C Blocking Peptide, catalog no. 33R-1220, is also available for use as a blocking control in assays to test for specificity of this SH2D3C antibody
• Additional Information
  This is a rabbit polyclonal antibody against SH2D3C, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  SH2D3C  
• Gene symbol
  SH2D3C
• Short name
  SH2D3C antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal SH2D3C antibody raised against the N terminal of SH2D3C
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:16884
• Gene
  SH2D3C
• Long gene name
  SH2 domain containing 3C
• Synonyms gene name
  • SH2 domain-containing 3C
• Synonyms
  • NSP3
• GenBank acession
  • AF124251
• Locus
  9q34.11
• Discovery year
  2001-11-19
• Entrez gene record
  10044
• Pubmed identfication
  • 10187783
• RefSeq identity
  • NM_005489
• Classification
  • SH2 domain containing
  • NSP adaptor proteins
• VEGA ID
  OTTHUMG00000020717

MeSH Data

• Name
  Electrophoresis, Gel, Two-Dimensional
• Concept
  Scope note: Electrophoresis in which a second perpendicular electrophoretic transport is performed on the separate components resulting from the first electrophoresis. This technique is usually performed on polyacrylamide gels.
• Tree numbers
  • E05.196.401.250
  • E05.301.300.230
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products