S100A9 Blocking Peptide

• Catalog number
  33R-6535
• Price
  Please ask
• Size
  100 ug

• Product Type
  Proteins
• Product Subtype
  Blocking Peptides
• Research Area
  Cell Biology
• Tag Conjugate
  MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLK
• Type1
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Applications
  WB, IHC
• Shipping Info
  Blue Ice
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  S100A9  
• Gene symbol
  S100A9
• Short name
  S100A9 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  S100 calcium binding protein A9 inhibiting short protein sequence
• Alternative technique
  control, peptides
• Alternative to gene target
  S100 calcium binding protein A9, 60B8AG and CAGB and CFAG and CGLB and L1AG and LIAG and MAC387 and MIF and MRP14 and NIF and P14, S100A9 and IDBG-102644 and ENSG00000163220 and 6280, RAGE receptor binding, nuclei, GM5849 and IDBG-705944 and ENSMUSG00000096621 and 545541, S100A9 and IDBG-632885 and ENSBTAG00000006505 and 532569

Gene info

• Identity
  HGNC:10499
• Gene
  S100A9
• Long gene name
  S100 calcium binding protein A9
• Synonyms gene
  • CAGB
  • CFAG
• Synonyms gene name
  • calgranulin B
  • S100 calcium-binding protein A9 (calgranulin B)
• Synonyms
  • P14
  • MIF
  • NIF
  • LIAG
  • MRP14
  • MAC387
  • 60B8AG
  • CGLB
  • MRP-14
  • S100-A9
• Synonyms name
  • Calprotectin L1H subunit
  • Leukocyte L1 complex heavy chain
  • Migration inhibitory factor-related protein 14
• GenBank acession
  • BC047681
• Locus
  1q21.3
• Discovery year
  1989-05-19
• Entrez gene record
  6280
• RefSeq identity
  • NM_002965
• Classification
  • S100 calcium binding proteins
  • EF-hand domain containing
• VEGA ID
  OTTHUMG00000013125

Similar products