RHOB antibody

• Catalog number
  70R-4030
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cancer
• Type of Immunogen
  RHOB antibodies were raised using the middle region of RHOB corresponding to a region with amino acids CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY
• Raised in
  Rabbit
• Specificity
  RHOB antibody was raised against the middle region of RHOB
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHOB antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  RHOB Blocking Peptide, catalog no. 33R-1769, is also available for use as a blocking control in assays to test for specificity of this RHOB antibody
• Additional Information
  This is a rabbit polyclonal antibody against RHOB, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  RHOB  
• Gene symbol
  RHOB
• Short name
  RHOB antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal RHOB antibody raised against the middle region of RHOB
• Alternative technique
  antibodies
• Alternative to gene target
  ras homolog family member B, ARH6 and ARHB and MST081 and MSTP081 and RHOH6, RHOB and IDBG-32465 and ENSG00000143878 and 388, GDP binding, nuclei, Rhob and IDBG-128375 and ENSMUSG00000054364 and 11852, RHOB and IDBG-648227 and ENSBTAG00000046054 and 515118

Gene info

• Identity
  HGNC:668
• Gene
  RHOB
• Long gene name
  ras homolog family member B
• Synonyms gene
  • ARH6
  • ARHB
• Synonyms gene name
  • ras homolog gene family, member B
• Synonyms
  • RHOH6
  • MST081
• Synonyms name
  • oncogene RHO H6
• Locus
  2p24.1
• Discovery year
  1997-04-16
• Entrez gene record
  388
• Pubmed identfication
  • 3283705
  • 16278215
• RefSeq identity
  • NM_004040
• Classification
  • Rho family GTPases
• VEGA ID
  OTTHUMG00000090755

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products