Rabbit ZDHHC16 antibody
-
Catalog number70R-6644
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenZDHHC16 antibody was raised using the C terminal of ZDHHC16 corresponding to a region with amino acids VLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTG
-
SpecificityZDHHC16 antibody was raised against the C terminal of ZDHHC16
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZDHHC16 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolZDHHC16
-
Short nameRabbit ZDHHC16 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ZDHHC16 antibody raised against the C terminal of ZDHHC16
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetzinc finger, DHHC-type containing 16, ZDHHC16 and IDBG-84965 and ENSG00000171307 and 84287, protein-cysteine S-palmitoyltransferase activity, Plasma membranes, Zdhhc16 and IDBG-166642 and ENSMUSG00000025157 and 74168, ZDHHC16 and IDBG-638238 and ENSBTAG00000012702 and 506085
-
Gene info
-
Identity
-
Gene
-
Long gene namezinc finger DHHC-type palmitoyltransferase 16
-
Synonyms gene name
- zinc finger DHHC-type containing 16
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2003-03-21
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Zinc fingers DHHC-type
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data