Rabbit YWHAZ antibody

  • Catalog number
    70R-1251
  • Price
    Please ask
  • Size
    100 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Signal Transduction
  • Immunogen
    YWHAZ antibody was raised using the C terminal of YWHAZ corresponding to a region with amino acids AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE
  • Specificity
    YWHAZ antibody was raised against the C terminal of YWHAZ
  • Cross Reactivity
    Human,Mouse,Rat,Dog
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of YWHAZ antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    YWHAZ  
  • Gene symbol
    YWHAZ
  • Short name
    Rabbit YWHAZ antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal YWHAZ antibody raised against the C terminal of YWHAZ
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide, 14-3-3-zeta and HEL-S-3 and HEL4 and KCIP-1 and YWHAD, YWHAZ and IDBG-30919 and ENSG00000164924 and 7534, poly(A) RNA binding, nuclei, Ywhaz and IDBG-135418 and ENSMUSG00000022285 and 102641764,22631, YWHAZ and IDBG-645101 and ENSBTAG00000000236 and 287022
Gene info
  • Identity
  • Gene
  • Long gene name
    tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta
  • Synonyms gene
  • Synonyms gene name
    • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide
    • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
  • Synonyms
  • Synonyms name
  • GenBank acession
  • Locus
  • Discovery year
    1993-09-20
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • 14-3-3 phospho-serine/phospho-threonine binding proteins
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee