Rabbit YWHAZ antibody
-
Catalog number70R-1251
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenYWHAZ antibody was raised using the C terminal of YWHAZ corresponding to a region with amino acids AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE
-
SpecificityYWHAZ antibody was raised against the C terminal of YWHAZ
-
Cross ReactivityHuman,Mouse,Rat,Dog
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of YWHAZ antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolYWHAZ
-
Short nameRabbit YWHAZ antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal YWHAZ antibody raised against the C terminal of YWHAZ
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targettyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide, 14-3-3-zeta and HEL-S-3 and HEL4 and KCIP-1 and YWHAD, YWHAZ and IDBG-30919 and ENSG00000164924 and 7534, poly(A) RNA binding, nuclei, Ywhaz and IDBG-135418 and ENSMUSG00000022285 and 102641764,22631, YWHAZ and IDBG-645101 and ENSBTAG00000000236 and 287022
-
Gene info
-
Identity
-
Gene
-
Long gene nametyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta
-
Synonyms gene
-
Synonyms gene name
- tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide
- tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1993-09-20
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- 14-3-3 phospho-serine/phospho-threonine binding proteins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data