Rabbit WWP2 antibody
-
Catalog number70R-2202
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProtein Modification & Stress Response
-
ImmunogenWWP2 antibody was raised using the middle region of WWP2 corresponding to a region with amino acids SSASTDHDPLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMIQEP
-
SpecificityWWP2 antibody was raised against the middle region of WWP2
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WWP2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolWWP2
-
Short nameRabbit WWP2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal WWP2 antibody raised against the middle region of WWP2
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetWW domain containing E3 ubiquitin protein ligase 2, AIP2 and WWp2-like, WWP2 and IDBG-39538 and ENSG00000198373 and 11060, ligase activity, nuclei, Wwp2 and IDBG-190874 and ENSMUSG00000031930 and 66894, WWP2 and IDBG-634611 and ENSBTAG00000018421 and 512457
-
Gene info
-
Identity
-
Gene
-
Long gene nameWW domain containing E3 ubiquitin protein ligase 2
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2004-07-07
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- HECT domain containing
- MicroRNA protein coding host genes
- C2 and WW domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data