Rabbit WNT5B antibody
-
Catalog number70R-5289
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenWNT5B antibody was raised using the middle region of WNT5B corresponding to a region with amino acids YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHC
-
SpecificityWNT5B antibody was raised against the middle region of WNT5B
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT5B antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolWNT5B
-
Short nameRabbit WNT5B antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal WNT5B antibody raised against the middle region of WNT5B
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetwingless-type MMTV integration site family, member 5B, WNT5B and IDBG-11885 and ENSG00000111186 and 81029, frizzled binding, Extracellular, Wnt5b and IDBG-182694 and ENSMUSG00000030170 and 22419, WNT5B and IDBG-641081 and ENSBTAG00000001341 and 508008
-
Gene info
-
Identity
-
Gene
-
Long gene nameWnt family member 5B
-
Synonyms gene name
- wingless-type MMTV integration site family, member 5B
-
GenBank acession
-
Locus
-
Discovery year2001-07-18
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Wnt family
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data