Rabbit WNT4 antibody

• Catalog number
  70R-7471
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  WNT4 antibody was raised using the middle region of WNT4 corresponding to a region with amino acids HGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNE
• Specificity
  WNT4 antibody was raised against the middle region of WNT4
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT4 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  WNT4  
• Gene symbol
  WNT4
• Short name
  Rabbit WNT4 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal WNT4 antibody raised against the middle region of WNT4
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  wingless-type MMTV integration site family, member 4, WNT4 and IDBG-93664 and ENSG00000162552 and 54361, receptor a this GO nist activity, Extracellular, Wnt4 and IDBG-198435 and ENSMUSG00000036856 and 22417, WNT4 and IDBG-645527 and ENSBTAG00000022671 and 789600

Gene info

• Identity
  HGNC:12783
• Gene
  WNT4
• Long gene name
  Wnt family member 4
• Synonyms gene name
  • wingless-type MMTV integration site family, member 4
• Synonyms
  • WNT-4
• GenBank acession
  • AL031281
• Locus
  1p36.12
• Discovery year
  2000-07-31
• Entrez gene record
  54361
• Pubmed identfication
  • 8168088
• Classification
  • Wnt family
• VEGA ID
  OTTHUMG00000002894

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products