Rabbit WNT3A antibody
-
Catalog number70R-5284
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenWNT3A antibody was raised using the N terminal of WNT3A corresponding to a region with amino acids MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP
-
SpecificityWNT3A antibody was raised against the N terminal of WNT3A
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT3A antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolWNT3A
-
Short nameRabbit WNT3A antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal WNT3A antibody raised against the N terminal of WNT3A
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetwingless-type MMTV integration site family, member 3A, WNT3A and IDBG-107120 and ENSG00000154342 and 89780, receptor a this GO nist activity, Extracellular, Wnt3a and IDBG-178528 and ENSMUSG00000009900 and 22416, BT.71501 and IDBG-641232 and ENSBTAG00000039397 and
-
Gene info
-
Identity
-
Gene
-
Long gene nameWnt family member 3A
-
Synonyms gene name
- wingless-type MMTV integration site family, member 3A
-
GenBank acession
-
Locus
-
Discovery year2001-06-29
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Wnt family
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data