Rabbit WNT2 antibody
-
Catalog number70R-5380
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenWNT2 antibody was raised using the middle region of WNT2 corresponding to a region with amino acids GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR
-
SpecificityWNT2 antibody was raised against the middle region of WNT2
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolWNT2
-
Short nameRabbit WNT2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal WNT2 antibody raised against the middle region of WNT2
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetwingless-type MMTV integration site family member 2, INT1L1 and IRP, WNT2 and IDBG-37593 and ENSG00000105989 and 7472, receptor a this GO nist activity, Extracellular, Wnt2 and IDBG-129144 and ENSMUSG00000010797 and 22413, WNT2 and IDBG-632785 and ENSBTAG00000008097 and 493729
-
Gene info
-
Identity
-
Gene
-
Long gene nameWnt family member 2
-
Synonyms gene
-
Synonyms gene name
- wingless-type MMTV integration site family member 2
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1988-08-05
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Wnt family
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data