Rabbit WNT10B antibody
-
Catalog number70R-5288
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenWNT10B antibody was raised using the middle region of WNT10B corresponding to a region with amino acids GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
-
SpecificityWNT10B antibody was raised against the middle region of WNT10B
-
Cross ReactivityHuman,Mouse
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT10B antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolWNT10B
-
Short nameRabbit WNT10B antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal WNT10B antibody raised against the middle region of WNT10B
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetwingless-type MMTV integration site family, member 10B, SHFM6 and WNT-12, WNT10B and IDBG-30678 and ENSG00000169884 and 7480, receptor a this GO nist activity, Extracellular, Wnt10b and IDBG-181195 and ENSMUSG00000022996 and 22410, WNT10B and IDBG-632758 and ENSBTAG00000015347 and
-
Gene info
-
Identity
-
Gene
-
Long gene nameWnt family member 10B
-
Synonyms gene name
- wingless-type MMTV integration site family, member 10B
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1997-09-05
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Wnt family
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data