Rabbit WNT1 antibody

• Catalog number
  70R-7124
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  WNT1 antibody was raised using the middle region of WNT1 corresponding to a region with amino acids FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV
• Specificity
  WNT1 antibody was raised against the middle region of WNT1
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  WNT1  
• Gene symbol
  WNT1
• Short name
  Rabbit WNT1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal WNT1 antibody raised against the middle region of WNT1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  wingless-type MMTV integration site family, member 1, BMND16 and INT1 and OI15, WNT1 and IDBG-30719 and ENSG00000125084 and 7471, receptor a this GO nist activity, Extracellular, Wnt1 and IDBG-181251 and ENSMUSG00000022997 and 22408, BT.101628 and IDBG-632755 and ENSBTAG00000015364 and 540662

Gene info

• Identity
  HGNC:12774
• Gene
  WNT1
• Long gene name
  Wnt family member 1
• Synonyms gene
  • INT1
• Synonyms gene name
  • wingless-type MMTV integration site family, member 1
• GenBank acession
  • X03072
• Locus
  12q13.12
• Discovery year
  2001-06-22
• Entrez gene record
  7471
• Pubmed identfication
  • 2998762
  • 3281802
• Classification
  • Wnt family
• VEGA ID
  OTTHUMG00000170403

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products