Rabbit WNK3 antibody
-
Catalog number70R-5768
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenWNK3 antibody was raised using the N terminal of WNK3 corresponding to a region with amino acids WVEDPKKLKGKHKDNEAIEFSFNLETDTPEEVAYEMVKSGFFHESDSKAV
-
SpecificityWNK3 antibody was raised against the N terminal of WNK3
-
Cross ReactivityHuman,Mouse
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNK3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolWNK3
-
Short nameRabbit WNK3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal WNK3 antibody raised against the N terminal of WNK3
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetWNK lysine deficient protein kinase 3, WNK3 and IDBG-71035 and ENSG00000196632 and 65267, transferase activity, Cell surfaces, Wnk3 and IDBG-178902 and ENSMUSG00000041245 and 279561, WNK3 and IDBG-637533 and ENSBTAG00000023182 and
-
Gene info
-
Identity
-
Gene
-
Long gene nameWNK lysine deficient protein kinase 3
-
Synonyms gene
-
Synonyms gene name
- protein kinase, lysine deficient 3
-
GenBank acession
-
Locus
-
Discovery year2001-02-07
-
Entrez gene record
-
RefSeq identity
-
Classification
- WNK lysine deficient protein kinases
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data