Rabbit VSIG1 antibody
-
Catalog number70R-7017
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenVSIG1 antibody was raised using the N terminal of VSIG1 corresponding to a region with amino acids SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN
-
SpecificityVSIG1 antibody was raised against the N terminal of VSIG1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VSIG1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolVSIG1
-
Short nameRabbit VSIG1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal VSIG1 antibody raised against the N terminal of VSIG1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetV-set and immunoglobulin domain containing 1, VSIG1 and IDBG-81752 and ENSG00000101842 and 340547, protein binding, Plasma membranes, Vsig1 and IDBG-175057 and ENSMUSG00000031430 and 78789, BT.28172 and IDBG-634088 and ENSBTAG00000007859 and 505937
-
Gene info
-
Identity
-
Gene
-
Long gene nameV-set and immunoglobulin domain containing 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2004-09-02
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- IgCAM CXADR-related subfamily
- V-set domain containing
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data