Rabbit VPS4A antibody
-
Catalog number70R-2879
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenVPS4A antibody was raised using a synthetic peptide corresponding to a region with amino acids LRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPN
-
SpecificityNA
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VPS4A antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolVPS4A
-
Short nameRabbit VPS4A antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal VPS4A antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetvacuolar protein sorting 4 homolog A (S. cerevisiae), VPS4A and IDBG-39000 and ENSG00000132612 and 27183, ATPase activity, Cytoplasm
-
Gene info
-
Identity
-
Gene
-
Long gene namevacuolar protein sorting 4 homolog A
-
Synonyms gene name
- vacuolar protein sorting 4A (yeast homolog)
- vacuolar protein sorting 4A (yeast)
- vacuolar protein sorting 4 homolog A (S. cerevisiae)
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2002-06-12
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- AAA ATPases
- ESCRT-IV
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data