Rabbit VPREB1 antibody
-
Catalog number70R-5905
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenVPREB1 antibody was raised using the middle region of VPREB1 corresponding to a region with amino acids TIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPP
-
SpecificityVPREB1 antibody was raised against the middle region of VPREB1
-
Cross ReactivityHuman,Mouse
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VPREB1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolVPREB1
-
Short nameRabbit VPREB1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal VPREB1 antibody raised against the middle region of VPREB1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetpre-B lymphocyte 1, IGI and IGVPB and VPREB, VPREB1 and IDBG-2196 and ENSG00000169575 and 7441, protein binding, multiple
-
Gene info
-
Identity
-
Gene
-
Long gene nameV-set pre-B cell surrogate light chain 1
-
Synonyms gene name
- pre-B lymphocyte 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1988-08-31
-
Entrez gene record
-
Pubmed identfication
-
Classification
- CD molecules
- V-set domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data