Rabbit UNC5C antibody
-
Catalog number70R-7135
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenUNC5C antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTS
-
SpecificityNA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UNC5C antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolUNC5C, UNC5C-AS1
-
Short nameRabbit UNC5C antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal UNC5C antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetunc-5 homolog C (C. elegans), UNC5H3, UNC5C and IDBG-30714 and ENSG00000182168 and 8633, protein binding, Plasma membranes, Unc5c and IDBG-196891 and ENSMUSG00000059921 and 22253, UNC5C and IDBG-640984 and ENSBTAG00000002084 and 533256
-
Gene info
-
Identity
-
Gene
-
Long gene nameunc-5 netrin receptor C
-
Synonyms gene name
- unc5 (C.elegans homolog) c
- unc-5 homolog C (C. elegans)
-
GenBank acession
-
Locus
-
Discovery year1998-12-09
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- I-set domain containing
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameUNC5C antisense RNA 1
-
Locus
-
Discovery year2020-09-17
-
Entrez gene record
-
Classification
- Antisense RNAs
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data